PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006856P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 905aa    MW: 101837 Da    PI: 7.0088
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006856P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix271.2e-082142652475
        trihelix  24 gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                     gk ++ + +ev+++++++g++r +k+   kw+n+ ++++k+ e+e++++ e+
  MELO3C006856P1 214 GKTRADKDREVAEYLQKHGVNRDAKTAGTKWDNMLGEFRKVYEWERGGEREQ 265
                     567888889*************************************996555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561124.16E-14739885IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.105.0E-6741849No hitNo description
CDDcd001804.72E-11746886No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 905 aa     Download sequence    Send to blast
MGEKGETPQQ QDHYDSSSPK DPLDDSLETR SHGGSHHHHG HHHHLHRRHQ HQHHDSSLIV  60
ATPFISTPLY LSTTATPTTT AFEAVNPKRT RYTAGQWKLL PSPTTSQPAI PVVGSDSSAS  120
PSQRRPGATS NVGPASSSDT TSSPSHSPLP ARSKGEGESQ NQAQYRKGKY VSPVWKPNEM  180
LWLARAWRVQ YQGGGSSNEI VGGTVVGQGG RGIGKTRADK DREVAEYLQK HGVNRDAKTA  240
GTKWDNMLGE FRKVYEWERG GEREQLVGKS YFRLSPYERK LHRLPASFDE QVFEELSQFM  300
GSKMRNKPTP ILPLTTSLPP PPPFRDHHNQ LPLSSRAKEV FGVDYGSVDA SCHRRIGKVR  360
MVWEESVSLW GEDQGVGGDQ EHRLGGRIRV EGDIFSLPEF VLNVANLRWF YSANTSWDYQ  420
DPTEYYVGCL RIPPTSLPSL SELSWHIQDP PSEELRFPIR KDAYAYLPQG KEVMFTTTTE  480
MLDCKSFIYE IICPIIRTNP CIATPSSRDS FISLWDDCIN RLVSEFCCME MQLIRKPSNP  540
PSSSSTTTDN LLDEWPNITG FIKKKFCLWR GEETDQIKDN GLNNNPSSSL VDKLLWTYLD  600
IPYVLGYYAI GYLVTFCALS RGQDNRIIRT DLYSLDLSSP SERLKALVPC YRIGGILTLL  660
AEQCNKLGVS SDFERIDVGN GIVVEMTPNL VTKFFSCRRK WTAVKEIYDF LDQRIPHSEY  720
IIGSIEKDLA LVFKPRVCKL RPTSYEQLIE ALKNVTKALV ALHDLCFMHR DICWEKVMKK  780
GRDHNDEDEN EEDEEMKRVK GEWILCGFEE AVGAPQIYPY TAASGRHAPE MGRGLHGVKV  840
DMWGVGYLIQ TCGLIGIPKM LMELQNRCMD QNPEHRPTAA DCYHHLLQLQ SSLSGAAGGS  900
GGLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652770.10.0PREDICTED: uncharacterized protein LOC101212506
TrEMBLA0A0A0L5Q90.0A0A0A0L5Q9_CUCSA; Uncharacterized protein
STRINGSolyc03g006900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.19e-07Trihelix family protein